PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_10157944g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 215aa    MW: 24451.5 Da    PI: 8.8064
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_10157944g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.23.4e-171562148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+eEd++l+ +++ +G g+W++ ++  g+ R++k+c++rw +yl
  MA_10157944g0010 15 KGAWTKEEDKRLIAYIEAHGEGSWRSLPKAAGLLRCGKSCRLRWINYL 62
                      79******************************99************97 PP

2Myb_DNA-binding57.62.9e-1868112147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       rg++++eEd+l+++++ +lG++ W++Ia +++ gRt++++k++w+++
  MA_10157944g0010  68 RGNFSEEEDDLIIKLHSLLGNK-WSLIAGRLP-GRTDNDIKNYWNTH 112
                       89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.7081062IPR017930Myb domain
SuperFamilySSF466891.87E-3014109IPR009057Homeodomain-like
SMARTSM007178.9E-131464IPR001005SANT/Myb domain
PfamPF002491.2E-151562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-231669IPR009057Homeodomain-like
CDDcd001671.86E-101762No hitNo description
PROSITE profilePS5129428.4663117IPR017930Myb domain
SMARTSM007172.8E-1767115IPR001005SANT/Myb domain
PfamPF002498.3E-1768112IPR001005SANT/Myb domain
CDDcd001671.35E-1270113No hitNo description
Gene3DG3DSA:1.10.10.608.1E-2870117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
MGRSPCCEKA HTNSKGAWTK EEDKRLIAYI EAHGEGSWRS LPKAAGLLRC GKSCRLRWIN  60
YLRPDVKRGN FSEEEDDLII KLHSLLGNKW SLIAGRLPGR TDNDIKNYWN THIKKKLLSK  120
GFDTQNHRPL GQPYNRCNNT SLSRPAADNE IPAFQNLRTP EIADFFQYDR PESSTIETAA  180
SKAQERPDLN LDLCMSLPFH SAPAEIRAST DDRNN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-29151177108B-MYB
1h8a_C7e-291411726128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006826645.16e-92PREDICTED: myb-related protein 308
SwissprotP200266e-85MYB1_HORVU; Myb-related protein Hv1
TrEMBLA9NYS61e-124A9NYS6_PICSI; Putative uncharacterized protein
STRINGBRADI4G36460.11e-86(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.19e-85myb domain protein 4